PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000983.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 282aa    MW: 31400.1 Da    PI: 8.2654
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000983.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP92.59.1e-2962131372
                      TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                              g+kdrhsk++T +g+RdRR+Rls+++a++++dLqd+LG+ ++sk ++WLl + k +i++l+ ++++++ +
  Itr_sc000983.1_g00007.1  62 GGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDATKLEIDKLPPLPFPPSFD 131
                              79*************************************************************8888832 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-2563123IPR005333Transcription factor, TCP
PROSITE profilePS5136928.87563121IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MMEKDFEANL KQEGCDDGKK NKAAEEMRKL GSSSTTSTSS SSRQWGGGFK NPRIVRVSRS  60
FGGKDRHSKV CTIRGLRDRR IRLSVPTAIQ LYDLQDRLGL SQPSKVVDWL LDATKLEIDK  120
LPPLPFPPSF DNSYNILQPP LPPPHFSHHD VMKTGKEKWI GEDDNSQDGG AGALALAAAY  180
NNNNNVVPQN FFPQKWIEPL APPPPPYYHW EPSTLSLAQF HDSHNNNNNP NNLYFPSILP  240
PPYMAAAPDA AAHFHHLLTT TTSTSSLTDN NHNHLEKSSR GS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016509420.18e-58PREDICTED: transcription factor TCP17-like
TrEMBLV4VMG04e-54V4VMG0_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5